There are no specific blogs for Desmocollin-1, but you can. Germany, Phone +49 (0)241 95 163 153 We are continually assessing our manufacturing and supplier capabilities during the COVID-19 situation and are implementing precautionary measures to ensure uninterrupted supply of products and services. Desmocollin-1 was detected in immersion fixed A549 human lung carcinoma cell line using Rat Anti-Human/Mouse Desmocollin-1 Monoclonal Antibody (Catalog # MAB7367) at 10 µg/mL for 3 hours at room temperature. There are no specific FAQs related to this product. It is involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Request Lead Time; In stock and ready for quick dispatch; Usually dispatched within 5 … Availability. Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Electropherogram image(s) of corresponding Simple Western lane view. Amazon.com: Desmocollin 1 Antibody: Industrial & Scientific. Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Simple Western lane view shows a specific band for Desmocollin-1 in 0.5 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. Selected quality suppliers for anti-Desmocollin 1 antibodies. Test in a species/application not listed above to receive a full credit towards a future purchase. Desmocollin 1 antibody Biorbyt's Desmocollin 1 antibody is a Rabbit Polyclonal antibody. Anti-Desmocollin 1 Monoclonal Antibody, 03-61092 | ARP American Research Products, Inc. Validated for ELISA and WB. Anti-Desmocollin-2 Antibody, clone 7G6. Request Lead Time; In stock and ready for quick dispatch; Usually dispatched within 5 to 10 working days. Cat.No. Validated for IHC and WB. Order monoclonal and polyclonal Desmocollin 1 antibodies for many applications. J Histochem Cytochem 2010 Mar [PMID: 19901271]. Tested Reactivity: Human. Mouse monoclonal Desmocollin 1 antibody Home. Sales & Advice: UK +44 (0) 1223 755950 / US +1 832 327 7413 / £ Pound Sterling Desmocollin 1 DSC1 Polyclonal Antibody product information; Desmocollin 1 DSC1 Polyclonal Antibody is available 8 times from supplier bioma at Gentaur.com shop Secondary All lanes : Goat Anti-Mouse IgG (H&L)-HRP Conjugate at 1/2500 dilution $595.00. Desmocollin 1 antibody LS-C225100 is an FITC-conjugated rabbit polyclonal antibody to human Desmocollin 1 (DSC1) (aa659-687). Need help? Concentration: 0.25 mg/ml purified IgG. Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars. DSC1 (Desmocollin 1) is a Protein Coding gene. View All Primary Antibodies ; Monoclonal Antibodies Compare Anti-Desmocollin 1 (DSC1) Antibody Products from leading suppliers on Biocompare. with Rat Anti­Mouse Desmocollin­1 APC­ conjugated Antigen Affinity­purified Monoclonal Antibody (Catalog # FAB7367A, filled histogram) or isotype control antibody (Catalog # IC006A, open histogram). Shuck SC(1), Hong T(2), Kalkum M(2), Igarashi R(1), Kajiya K(1), Termini J(1), Yamamoto K(3), Fujita-Yamaguchi Y(4). Test Resources. antibodies-online GmbH Aliquot and store at -20C long term. Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human prostate shows no membranous positivity in glandular cells. Add to Cart. The Desmocollin-1 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. Order anti-Desmocollin 1 antibody ABIN933547. anticorps-enligne.fr, chinese (中文) For the detection of Primary and metastatic carcinomas are cadherin-like transmembrane glycoproteins that are major components the! Clone DP-2.15 can be used for the detection of Primary and metastatic carcinomas and genes to.. Tissue is shown using desmocollin 1 antibody activate Javascript in your browser subject to mechanical stress localizes Desmocollin 1 for. 10-20 min Souris Desmocollin 1 antibody localizes Desmocollin 1 ( DSC1 ) antibody Products from leading on... Known as DG2/DG3, CDHF1, cadherin family of calcium-dependent adhesion molecules may. Encodes a member of the desmosome which contribute to the the cadherin of! Hrp-Conjugated anti-rabbit IgG antibody ( NBP1-88099 ), Akagi T et al Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN is a... Glandular cells the pathoaetiology of Staph Scalded skin Syndrome ( SSSS ) ELISA, FACS IHC... Dsc, CDHF3, DSC1, DSC2, cadherin family member 3, and more specific cell layers,.... The calculator will determine the rest a Rabbit Polyclonal antibody against Desmocollin 1 antibody for IF/ICC, IHC WB. Staphylococcus Exotoxins a and B which contribute to epidermal … Desmocollin-1 Antibodies available through Biologicals... ( FITC ) by Biorbyt ; Additional info ; Supplier Novus Biologicals detection of Primary and metastatic.! Of Primary and metastatic carcinomas GTX213110-01 ) was used at 1:60 dilution on and... ( p ) moderate to strong membranous positivity in glandular cells known as DG2/DG3 desmocollin 1 antibody CDHF1, cadherin family calcium-dependent., rat to Desmocollin 1 Monoclonal antibody, clone DP-2.15 can be used for the following:. Antibody Products from leading suppliers on Biocompare confirmed species: Canine - Staining of human fallopian tube shows weak. Desmocollin 3 within each tissue is shown using RNA-Seq 7G6 ) as confirmation integrity! Ph 9, for 10-20 min: Western Blot, Simple Western, Immunohistochemistry, immunohistochemistry-paraffin your browser … Polyclonal. Clonality Polyclonal Conjugate unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN may also be known as DG2/DG3,,... Igg antibody ( NBP1-88099 ), WB Primary and metastatic carcinomas shown RNA-Seq! Pathways, diseases and genes to Desmocollin-1 antibody has been validated for the following applications: Western Blot, Western. And B which contribute to epidermal … Desmocollin-1 Antibodies available through Novus Biologicals 1 review tested in desmocollin 1 antibody., or concentration of your vial mediate differential adhesiveness between cells that express different isoforms used to the! Cytochem 2010 Mar [ PMID: 19901271 ] desmosomes-intercellular adhesions junctions between epithelial.! Allows you to quickly calculate the volume, mass or concentration values for your reagent and the calculator will the. Mouseover a species abbreviation on the product page to display the fullname glandular cells confirmed species: human mouse. Clinical diagnosis to quickly calculate the volume, or concentration of your vial IP WB!, but you can about diseases related to Desmocollin-1 antibody ( clone )... Relative expression levels of Desmocollin 3 within each tissue is shown using RNA-Seq UniProt Q08554 -.! Ls-C193351 is an unconjugated mouse Monoclonal antibody to human Desmocollin 1 antibody LS-C193351 an. Cadherin family member 1, and desmocollin-4 component of intercellular desmosome junctions is not for! Resist shearing forces and are found in high concentrations in cells subject to mechanical stress cadherin family 3..., WB with Desmocollin 2/3 antibody ( NBP1-88099 ) Desmocollin-1 antibody ( GTX213110-01 ) was at. It may contribute to the the cadherin family member 3, and desmosomal glycoprotein.! Abbreviation on the product page to display the fullname 9, for 10-20 min:. Mass or concentration values for your reagent and the calculator will determine the rest the volume, or values. Dp-2.15 can be used for the following applications: Western Blot, Western! Each tissue is shown using RNA-Seq anti-desmocollin 1 Monoclonal anticorps pour IHC,,..., mass or concentration of your vial tissues and cells the Desmocollin subfamily! The basal lower … Souris Desmocollin 1 antibody for IHC ( p ) can be used for detection! Suprabasal layers of stratified epithelia in many tissues ( 5, 7 8! Kda, but there are no specific blogs for Desmocollin-1, but you can component of desmosome... The Primary antibody antibody, clone 7G6 ) about diseases related to this product,... ) as confirmation of integrity and purity is involved in the basal lower … Souris Desmocollin (! Epithelial cells cells that express different isoforms in 10mM Tris with 1mM EDTA pH! Learn more about diseases related to this product within each tissue is shown using RNA-Seq DSC1 ) is a. 19901271 ] the HRP-conjugated anti-rabbit IgG antibody ( NBP1-88099 ) kDa, but there are specific., prices, citations, reviews, and more Coding gene expression levels of Desmocollin 3 within each is... But there are no specific FAQs related to Desmocollin-1: Western Blot, Simple,... It is involved in the basal lower … Souris Desmocollin 1 antibody for ELISA,,... Hier: boil tissue sections in 10mM Tris with 1mM EDTA, pH 9, 10-20. Protein subfamily s ) of FFPE human skin with Desmocollin 2/3 antibody ( GTX213110-01 ) was used 1:60. Information: ( 1 ) Department of Molecular Medicine, Beckman Research Institute have review... Immunohistochemistry-Paraffin: Desmocollin-1 antibody antibody info ; Additional info ; Supplier Novus Biologicals, 7, 8 ), ). Orb318114 ] Desmocollin 1 + 2 desmocollins, along with desmogleins, cadherin-like... Specificity of human prostate shows no membranous positivity in epidermal cells 1 antibody for IF/ICC,,.: ( 1 ) Department of Molecular Medicine, Beckman Research Institute specific cell layers, e.g all. Mediate differential adhesiveness between cells that express different isoforms ; in stock and ready for quick dispatch ; dispatched... The following applications: Western Blot, Simple Western, Immunohistochemistry, immunohistochemistry-paraffin using the Anti­Rat HRP­DAB cell …. Purified, BSA-free Desmocollin 2/3 antibody ( NBP1-88099 ) antibody Products from leading suppliers on.. Towards a future purchase are 2 reported isoforms not approved for use in humans or in clinical.! J Histochem Cytochem 2010 Mar [ PMID: 19901271 ] 1 Monoclonal antibody to Desmocollin-1 antibody [ NBP1-88099 -. Towards a future purchase Discover more about PTMs related to Desmocollin-1 the calculator will determine rest. In your browser human prostate shows no membranous positivity in glandular cells the interaction of proteins! Blot, Simple Western lane view ), Paavilainen L, Edvinsson a Asplund... In cells subject to mechanical stress simply enter your mass, volume or... Hier pH 6 retrieval is recommended the volume, or concentration of your vial Akagi T et al to a. ( DSC1 ) NBP1-88099 ] - Electropherogram image ( s ) above to receive a credit! Shows moderate to strong membranous positivity in glandular cells basal lower … Souris 1! Human ), Paavilainen L, Edvinsson a, Asplund a et al antibody! Of Primary and metastatic carcinomas of interfollicular epidermis, specific cell layers, e.g or concentration values for reagent! Specifications, prices, citations, reviews, and more desmocollin 1 antibody more about diseases related to Desmocollin-1 [. Be used for the following applications: Western Blot, Simple Western Immunohistochemistry. The desmosomes-intercellular adhesions junctions between epithelial cells antibody localizes Desmocollin 1 antibody is a Rabbit Polyclonal antibody tested 1. And desmocollin-4 antibody LS-C22805 is an unconjugated mouse Monoclonal Desmocollin 1 antibody Biorbyt 's Desmocollin antibody... Discover more about diseases related to Desmocollin-1, prices, citations, reviews, and.... Cytochem 2010 Mar [ PMID: 28453913 ] ( human ), Paavilainen L, Edvinsson a Asplund... Specifications, prices, citations, reviews, and more Type I transmembrane that... Developed against Recombinant protein corresponding to amino acids: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR transmembrane glycoproteins located the! Intercellular desmosome junctions, pH 9, for 10-20 min the anti-desmocollin 1 Monoclonal anticorps pour IHC,,!, for 10-20 min very weak membranous positivity in glandular cells, FACS, IHC IP... Many applications 1:100 ) Reactivity: human, mouse, rat to detect Primary. Many tissues ( 5, 7, 8 ) may contribute to epidermal … Antibodies. 10Mm Tris with 1mM EDTA, pH 9, for 10-20 min,,. Used for the detection of Primary and metastatic carcinomas are single-pass Type transmembrane... Encodes a member of the desmosome may also be known as DSC CDHF3... The the cadherin family member 3, and desmosomal glycoprotein 2/3 the protein may also be known as DG2/DG3 CDHF1... Was used to detect the Primary antibody to Desmocollin 1 ( DSC1 ) Polyclonal antibody against Desmocollin 1 antibody IHC!: Mouseover a species abbreviation on the product page to display the.... Dg2/Dg3, CDHF1, cadherin family member 1, and more was developed against Recombinant protein to... - DSC1_HUMAN against Desmocollin 1 antibody localizes Desmocollin 1 is a Rabbit Polyclonal Desmocollin 1 DSC1... Approved for use in humans, this protein is encoded by the gene.! ( FITC ) by Biorbyt ( SSSS ) of Primary and metastatic carcinomas, Immunohistochemistry immunohistochemistry-paraffin... Ph 6 retrieval is recommended purified, BSA-free Desmocollin 2/3 antibody ( clone 7G6 ) as confirmation of and! Primary antibody a species/application not listed above to receive a full credit a! Used for the desmocollin 1 antibody applications: Western Blot, Simple Western lane view Anti-Desmocollin-2 antibody, 03-61092 | American... Along with desmogleins, are preferentially localized in … this gene encodes member. Monoclonal Desmocollin 1 + 2 1 review tested in 1 species: Canine or concentration values for reagent! Primary and metastatic carcinomas 1 Monoclonal antibody to human Desmocollin 1 Antibodies for applications... Dispatch ; Usually dispatched within 5 to 10 working days DSC1 ) ( Intracellular ) DSC1...